![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
![]() | Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
![]() | Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
![]() | Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries) Uniprot P60488 1-139 |
![]() | Domain d1vsah1: 1vsa H:25-161 [144521] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to 2J01 N:1-139 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsah1 c.21.1.1 (H:25-161) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk vyagpdhphqaqrpekl
Timeline for d1vsah1: