![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [159878] (28 PDB entries) Uniprot P02424 1-99 |
![]() | Domain d1vs8t1: 1vs8 T:1-99 [144514] Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1 automatically matched to 2AW4 T:1-99 complexed with mg |
PDB Entry: 1vs8 (more details), 3.46 Å
SCOP Domain Sequences for d1vs8t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs8t1 d.12.1.1 (T:1-99) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} mireerllkvlraphvsekastameksntivlkvakdatkaeikaavqklfevevevvnt lvvkgkvkrhgqrigrrsdwkkayvtlkegqnldfvgga
Timeline for d1vs8t1:
![]() Domains from other chains: (mouse over for more information) d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1 |