Lineage for d1vs8i1 (1vs8 I:73-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763229Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 763249Domain d1vs8i1: 1vs8 I:73-141 [144506]
    Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
    automatically matched to 2AW4 I:73-141
    complexed with mg

Details for d1vs8i1

PDB Entry: 1vs8 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d1vs8i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs8i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOP Domain Coordinates for d1vs8i1:

Click to download the PDB-style file with coordinates for d1vs8i1.
(The format of our PDB-style files is described here.)

Timeline for d1vs8i1: