Lineage for d1vs7r1 (1vs7 R:19-73)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984966Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1984967Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1984968Protein Ribosomal protein S18 [46913] (2 species)
  7. 1984969Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1984981Domain d1vs7r1: 1vs7 R:19-73 [144493]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7s1, d1vs7t1, d1vs7u1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs7r1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1vs7r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d1vs7r1:

Click to download the PDB-style file with coordinates for d1vs7r1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7r1: