Lineage for d1vs7k1 (1vs7 K:12-128)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1860419Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1860420Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1860510Protein Ribosomal protein S11 [53141] (2 species)
  7. 1860511Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 1860523Domain d1vs7k1: 1vs7 K:12-128 [144486]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs7k1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1vs7k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7k1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOPe Domain Coordinates for d1vs7k1:

Click to download the PDB-style file with coordinates for d1vs7k1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7k1: