Lineage for d1vs7j1 (1vs7 J:5-102)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909920Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 1909921Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1909922Protein Ribosomal protein S10 [55001] (2 species)
  7. 1909923Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 1909935Domain d1vs7j1: 1vs7 J:5-102 [144485]
    Other proteins in same PDB: d1vs7b1, d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs7j1

PDB Entry: 1vs7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1vs7j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs7j1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d1vs7j1:

Click to download the PDB-style file with coordinates for d1vs7j1.
(The format of our PDB-style files is described here.)

Timeline for d1vs7j1: