| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
| Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
| Protein Ribosomal protein S2 [52315] (3 species) |
| Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
| Domain d1vs7b1: 1vs7 B:8-225 [144476] Other proteins in same PDB: d1vs7c1, d1vs7c2, d1vs7d1, d1vs7e1, d1vs7e2, d1vs7f1, d1vs7g1, d1vs7h1, d1vs7i1, d1vs7j1, d1vs7k1, d1vs7l1, d1vs7m1, d1vs7n1, d1vs7o1, d1vs7p1, d1vs7q1, d1vs7r1, d1vs7s1, d1vs7t1, d1vs7u1 complexed with ksg, mg complexed with ksg, mg |
PDB Entry: 1vs7 (more details), 3.46 Å
SCOPe Domain Sequences for d1vs7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs7b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d1vs7b1: