Lineage for d1vs6i2 (1vs6 I:1-72)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904110Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 1904111Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 1904112Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 1904116Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 1904122Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 1904136Domain d1vs6i2: 1vs6 I:1-72 [144466]
    Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6c1, d1vs6c2, d1vs6d1, d1vs6e1, d1vs6f1, d1vs6g1, d1vs6g2, d1vs6h1, d1vs6h2, d1vs6i1, d1vs6j1, d1vs6k1, d1vs6l1, d1vs6m1, d1vs6n1, d1vs6o1, d1vs6p1, d1vs6q1, d1vs6r1, d1vs6s1, d1vs6t1, d1vs6u1, d1vs6v1, d1vs6w1, d1vs6x1, d1vs6y1, d1vs6z1
    complexed with mg
    complexed with mg

Details for d1vs6i2

PDB Entry: 1vs6 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1vs6i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs6i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d1vs6i2:

Click to download the PDB-style file with coordinates for d1vs6i2.
(The format of our PDB-style files is described here.)

Timeline for d1vs6i2: