Lineage for d1vs6i1 (1vs6 I:73-141)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308822Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2308836Domain d1vs6i1: 1vs6 I:73-141 [144465]
    Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6c1, d1vs6c2, d1vs6d1, d1vs6e1, d1vs6f1, d1vs6g1, d1vs6g2, d1vs6h1, d1vs6h2, d1vs6i2, d1vs6j1, d1vs6k1, d1vs6l1, d1vs6m1, d1vs6n1, d1vs6o1, d1vs6p1, d1vs6q1, d1vs6r1, d1vs6s1, d1vs6t1, d1vs6u1, d1vs6v1, d1vs6w1, d1vs6x1, d1vs6y1, d1vs6z1
    complexed with mg
    complexed with mg

Details for d1vs6i1

PDB Entry: 1vs6 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1vs6i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs6i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d1vs6i1:

Click to download the PDB-style file with coordinates for d1vs6i1.
(The format of our PDB-style files is described here.)

Timeline for d1vs6i1: