Lineage for d1vs6c2 (1vs6 C:61-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399426Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2399436Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2399450Domain d1vs6c2: 1vs6 C:61-124 [144457]
    Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6c1, d1vs6d1, d1vs6e1, d1vs6f1, d1vs6g1, d1vs6g2, d1vs6h1, d1vs6h2, d1vs6i1, d1vs6i2, d1vs6j1, d1vs6k1, d1vs6l1, d1vs6m1, d1vs6n1, d1vs6o1, d1vs6p1, d1vs6q1, d1vs6r1, d1vs6s1, d1vs6t1, d1vs6u1, d1vs6v1, d1vs6w1, d1vs6x1, d1vs6y1, d1vs6z1
    complexed with mg
    complexed with mg

Details for d1vs6c2

PDB Entry: 1vs6 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1vs6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs6c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d1vs6c2:

Click to download the PDB-style file with coordinates for d1vs6c2.
(The format of our PDB-style files is described here.)

Timeline for d1vs6c2: