Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) automatically mapped to Pfam PF01649 |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (2 species) |
Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
Domain d1vs5t1: 1vs5 T:2-86 [144454] Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5u1 complexed with ksg, mg complexed with ksg, mg |
PDB Entry: 1vs5 (more details), 3.46 Å
SCOPe Domain Sequences for d1vs5t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs5t1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa akglihknkaarhkanltaqinkla
Timeline for d1vs5t1: