Lineage for d1vs5q1 (1vs5 Q:3-82)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790014Protein Ribosomal protein S17 [50304] (3 species)
  7. 2790017Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 2790028Domain d1vs5q1: 1vs5 Q:3-82 [144451]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    complexed with ksg, mg
    complexed with ksg, mg

Details for d1vs5q1

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1vs5q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5q1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d1vs5q1:

Click to download the PDB-style file with coordinates for d1vs5q1.
(The format of our PDB-style files is described here.)

Timeline for d1vs5q1: