Lineage for d1vs5p1 (1vs5 P:1-82)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200238Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1200239Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1200240Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1200241Protein Ribosomal protein S16 [54567] (3 species)
  7. 1200244Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1200253Domain d1vs5p1: 1vs5 P:1-82 [144450]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    automatically matched to 2AVY P:1-82
    complexed with ksg, mg

Details for d1vs5p1

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1vs5p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5p1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d1vs5p1:

Click to download the PDB-style file with coordinates for d1vs5p1.
(The format of our PDB-style files is described here.)

Timeline for d1vs5p1: