![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
![]() | Domain d1vs5d1: 1vs5 D:1-205 [144438] Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1 complexed with ksg, mg complexed with ksg, mg |
PDB Entry: 1vs5 (more details), 3.46 Å
SCOPe Domain Sequences for d1vs5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs5d1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d1vs5d1: