Lineage for d1vs5d1 (1vs5 D:1-205)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655967Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1655968Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1655969Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1655970Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1655974Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 1655985Domain d1vs5d1: 1vs5 D:1-205 [144438]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    automatically matched to 2AVY D:1-205
    complexed with ksg, mg

Details for d1vs5d1

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1vs5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5d1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

SCOPe Domain Coordinates for d1vs5d1:

Click to download the PDB-style file with coordinates for d1vs5d1.
(The format of our PDB-style files is described here.)

Timeline for d1vs5d1: