SCOPe 2.05: Domain d1vs5c1: 1vs5 C:1-105

Lineage for d1vs5c1 (1vs5 C:1-105)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d1vs5c1: 1vs5 C:1-105 [144436]
   Other proteins in same PDB: d1vs5b1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5h1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
   complexed with ksg, mg
   complexed with ksg, mg

Details for d1vs5c1

PDB Entry: 1vs5, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1vs5c1:

Sequence; same for both SEQRES and ATOM records:

>d1vs5c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d1vs5c1:

• d1vs5c1 first appeared in SCOP 1.75
  
• d1vs5c1 appears in SCOPe 2.04
  
• d1vs5c1 appears in SCOPe 2.06
  
• d1vs5c1 appears in the current release, SCOPe 2.08