![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Hypothetical protein TM0892, CBS tandem [143136] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [143137] (1 PDB entry) Uniprot Q9WZZ4 1-60! Uniprot Q9WZZ4 61-121 |
![]() | Domain d1vr9a3: 1vr9 A:1-121 [144433] |
PDB Entry: 1vr9 (more details), 1.7 Å
SCOPe Domain Sequences for d1vr9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} mkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvvnkedlldldlds svfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavslhdflealieal a
Timeline for d1vr9a3: