Lineage for d1vr9a3 (1vr9 A:1-121)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858507Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 858508Superfamily d.37.1: CBS-domain pair [54631] (1 family) (S)
  5. 858509Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 858540Protein Hypothetical protein TM0892, CBS tandem [143136] (1 species)
  7. 858541Species Thermotoga maritima [TaxId:2336] [143137] (1 PDB entry)
    Uniprot Q9WZZ4 1-60! Uniprot Q9WZZ4 61-121
  8. 858542Domain d1vr9a3: 1vr9 A:1-121 [144433]

Details for d1vr9a3

PDB Entry: 1vr9 (more details), 1.7 Å

PDB Description: crystal structure of a cbs domain pair/act domain protein (tm0892) from thermotoga maritima at 1.70 a resolution
PDB Compounds: (A:) CBS domain protein/ACT domain protein

SCOP Domain Sequences for d1vr9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]}
mkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvvnkedlldldlds
svfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavslhdflealieal
a

SCOP Domain Coordinates for d1vr9a3:

Click to download the PDB-style file with coordinates for d1vr9a3.
(The format of our PDB-style files is described here.)

Timeline for d1vr9a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vr9b3