SCOP 1.75: Domain d1vqog1: 1vqo G:12-73

Lineage for d1vqog1 (1vqo G:12-73)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1vqog1: 1vqo G:12-73 [144430]
   Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to 1VQ4 G:12-73
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqog1

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1vqog1:

Sequence, based on SEQRES records:

>d1vqog1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1vqog1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1vqog1:

• d1vqog1 is new in SCOP 1.75
  
• d1vqog1 appears in SCOPe 2.01
  
• d1vqog1 appears in the current release, SCOPe 2.08