Lineage for d1vq8g1 (1vq8 G:12-73)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651728Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 2651729Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 2651730Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 2651731Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 2651732Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 2651733Domain d1vq8g1: 1vq8 G:12-73 [144418]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to 1VQ4 G:12-73
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8g1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1vq8g1:

Sequence, based on SEQRES records: (download)

>d1vq8g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1vq8g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1vq8g1:

Click to download the PDB-style file with coordinates for d1vq8g1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8g1: