![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
![]() | Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) ![]() |
![]() | Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
![]() | Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
![]() | Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
![]() | Domain d1vq6g1: 1vq6 G:12-73 [144414] Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 automatically matched to 1VQ4 G:12-73 protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1vq6 (more details), 2.7 Å
SCOPe Domain Sequences for d1vq6g1:
Sequence, based on SEQRES records: (download)
>d1vq6g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
>d1vq6g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesrntlleraldd
Timeline for d1vq6g1:
![]() Domains from other chains: (mouse over for more information) d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 |