SCOPe 2.08: Domain d1vq421: 1vq4 2:1-49

Lineage for d1vq421 (1vq4 2:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d1vq421: 1vq4 2:1-49 [144409]
   Other proteins in same PDB: d1vq411, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq421

PDB Entry: 1vq4, 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1vq421:

Sequence, based on SEQRES records:

>d1vq421 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1vq421 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d1vq421:

• d1vq421 first appeared in SCOP 1.75
  
• d1vq421 appears in SCOPe 2.07