Lineage for d1vgka2 (1vgk A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897758Species Mouse (Mus musculus), H-2KD [TaxId:10090] [160078] (4 PDB entries)
    Uniprot P01902 22-202
  8. 1897759Domain d1vgka2: 1vgk A:1-181 [144408]
    Other proteins in same PDB: d1vgka1, d1vgkb_
    automatically matched to 2FWO A:1-181

Details for d1vgka2

PDB Entry: 1vgk (more details), 2.06 Å

PDB Description: The crystal structure of class I Major histocompatibility complex, H-2Kd at 2.0 A resolution
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d1vgka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KD [TaxId: 10090]}
gphslryfvtavsrpglgeprfiavgyvddtqfvrfdsdadnprfeprapwmeqegpeyw
eeqtqraksdeqwfrvslrtaqryynqskggshtfqrmfgcdvgsdwrllrgyqqfaydg
rdyialnedlktwtaadtaalitrrkweqagdaeyyraylegecvewlrrylelgnetll
r

SCOPe Domain Coordinates for d1vgka2:

Click to download the PDB-style file with coordinates for d1vgka2.
(The format of our PDB-style files is described here.)

Timeline for d1vgka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1vgkb_