SCOPe 2.07: Domain d1vgka1: 1vgk A:182-274

Lineage for d1vgka1 (1vgk A:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d1vgka1: 1vgk A:182-274 [144407]
   Other proteins in same PDB: d1vgka2, d1vgkb_
   automatically matched to 2FWO A:182-275

Details for d1vgka1

PDB Entry: 1vgk, 2.06 Å

PDB Description: The crystal structure of class I Major histocompatibility complex, H-2Kd at 2.0 A resolution

PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d1vgka1:

Sequence; same for both SEQRES and ATOM records:

>d1vgka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrw

Timeline for d1vgka1:

• d1vgka1 first appeared in SCOP 1.75
  
• d1vgka1 appears in SCOPe 2.06