Lineage for d1uzhw_ (1uzh W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957691Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2957735Domain d1uzhw_: 1uzh W: [144405]
    Other proteins in same PDB: d1uzha1, d1uzha2, d1uzhb1, d1uzhb2, d1uzhe1, d1uzhe2, d1uzhh1, d1uzhh2, d1uzhk1, d1uzhk2, d1uzho1, d1uzho2, d1uzhr1, d1uzhr2, d1uzhv1, d1uzhv2
    automated match to d1uzhc1
    complexed with cap, edo, mg

Details for d1uzhw_

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (W:) ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1uzhw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzhw_ d.73.1.1 (W:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
sv

SCOPe Domain Coordinates for d1uzhw_:

Click to download the PDB-style file with coordinates for d1uzhw_.
(The format of our PDB-style files is described here.)

Timeline for d1uzhw_: