Lineage for d1uzht1 (1uzh T:1-122)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865071Domain d1uzht1: 1uzh T:1-122 [144404]
    Other proteins in same PDB: d1uzha1, d1uzha2, d1uzhb1, d1uzhb2, d1uzhe1, d1uzhe2, d1uzhh1, d1uzhh2, d1uzhk1, d1uzhk2, d1uzho1, d1uzho2, d1uzhr1, d1uzhr2, d1uzhv1, d1uzhv2
    automatically matched to 1UZH C:1-122
    complexed with cap, edo, mg

Details for d1uzht1

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (T:) ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain

SCOP Domain Sequences for d1uzht1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzht1 d.73.1.1 (T:1-122) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
sv

SCOP Domain Coordinates for d1uzht1:

Click to download the PDB-style file with coordinates for d1uzht1.
(The format of our PDB-style files is described here.)

Timeline for d1uzht1: