| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries) |
| Domain d1uzhc1: 1uzh C:1-122 [144398] Other proteins in same PDB: d1uzha1, d1uzha2, d1uzhb1, d1uzhb2, d1uzhe1, d1uzhe2, d1uzhh1, d1uzhh2, d1uzhk1, d1uzhk2, d1uzho1, d1uzho2, d1uzhr1, d1uzhr2, d1uzhv1, d1uzhv2 chimera with Synechococcus sequence complexed with cap, edo, mg |
PDB Entry: 1uzh (more details), 2.2 Å
SCOPe Domain Sequences for d1uzhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzhc1 d.73.1.1 (C:1-122) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
sv
Timeline for d1uzhc1: