SCOP 1.75: Domain d1uzhc1: 1uzh C:1-122

Lineage for d1uzhc1 (1uzh C:1-122)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)

8. Domain d1uzhc1: 1uzh C:1-122 [144398]
   Other proteins in same PDB: d1uzha1, d1uzha2, d1uzhb1, d1uzhb2, d1uzhe1, d1uzhe2, d1uzhh1, d1uzhh2, d1uzhk1, d1uzhk2, d1uzho1, d1uzho2, d1uzhr1, d1uzhr2, d1uzhv1, d1uzhv2
   chimera with Synechococcus sequence
   complexed with cap, edo, mg

Details for d1uzhc1

PDB Entry: 1uzh, 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme

PDB Compounds: (C:) ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain

SCOP Domain Sequences for d1uzhc1:

Sequence; same for both SEQRES and ATOM records:

>d1uzhc1 d.73.1.1 (C:1-122) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
sv

Timeline for d1uzhc1:

• d1uzhc1 is new in SCOP 1.75
  
• d1uzhc1 appears in SCOPe 2.01
  
• d1uzhc1 appears in the current release, SCOPe 2.08