Lineage for d1uzdt_ (1uzd T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524231Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2524250Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2524301Domain d1uzdt_: 1uzd T: [144396]
    Other proteins in same PDB: d1uzda1, d1uzda2, d1uzdb1, d1uzdb2, d1uzde1, d1uzde2, d1uzdh1, d1uzdh2, d1uzdk1, d1uzdk2, d1uzdo1, d1uzdo2, d1uzdr1, d1uzdr2, d1uzdv1, d1uzdv2
    automated match to d1uzdc1
    complexed with cap, edo, mg

Details for d1uzdt_

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (T:) ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2

SCOPe Domain Sequences for d1uzdt_:

Sequence, based on SEQRES records: (download)

>d1uzdt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
ktardfqpankrsv

Sequence, based on observed residues (ATOM records): (download)

>d1uzdt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
kqpankrsv

SCOPe Domain Coordinates for d1uzdt_:

Click to download the PDB-style file with coordinates for d1uzdt_.
(The format of our PDB-style files is described here.)

Timeline for d1uzdt_: