Lineage for d1uzdi1 (1uzd I:1-134)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865091Domain d1uzdi1: 1uzd I:1-134 [144392]
    Other proteins in same PDB: d1uzda1, d1uzda2, d1uzdb1, d1uzdb2, d1uzde1, d1uzde2, d1uzdh1, d1uzdh2, d1uzdk1, d1uzdk2, d1uzdo1, d1uzdo2, d1uzdr1, d1uzdr2, d1uzdv1, d1uzdv2
    automatically matched to 1UZD C:1-134
    complexed with cap, edo, mg

Details for d1uzdi1

PDB Entry: 1uzd (more details), 2.4 Å

PDB Description: chlamydomonas,spinach chimeric rubisco
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2

SCOP Domain Sequences for d1uzdi1:

Sequence, based on SEQRES records: (download)

>d1uzdi1 d.73.1.1 (I:1-134) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
ktardfqpankrsv

Sequence, based on observed residues (ATOM records): (download)

>d1uzdi1 d.73.1.1 (I:1-134) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
kqpankrsv

SCOP Domain Coordinates for d1uzdi1:

Click to download the PDB-style file with coordinates for d1uzdi1.
(The format of our PDB-style files is described here.)

Timeline for d1uzdi1: