Lineage for d1u5sa1 (1u5s A:1-71)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120860Protein Nck-2 [159019] (1 species)
  7. 1120861Species Human (Homo sapiens) [TaxId:9606] [159020] (1 PDB entry)
    Uniprot O43639 192-262
    unclassified SH3 domains of this protein species are: 1WX6, 2B86, 2FRW, 2FRY
  8. 1120862Domain d1u5sa1: 1u5s A:1-71 [144389]
    Other proteins in same PDB: d1u5sb1, d1u5sb2
    third SH3 domain
    complexed with zn

Details for d1u5sa1

PDB Entry: 1u5s (more details)

PDB Description: nmr structure of the complex between nck-2 sh3 domain and pinch-1 lim4 domain
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d1u5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]}
qgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpkny
vvvlsdgpalh

SCOPe Domain Coordinates for d1u5sa1:

Click to download the PDB-style file with coordinates for d1u5sa1.
(The format of our PDB-style files is described here.)

Timeline for d1u5sa1: