Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Nck-2 [159019] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159020] (1 PDB entry) Uniprot O43639 192-262 unclassified SH3 domains of this protein species are: 1WX6, 2B86, 2FRW, 2FRY |
Domain d1u5sa1: 1u5s A:1-71 [144389] Other proteins in same PDB: d1u5sb1, d1u5sb2 third SH3 domain complexed with zn |
PDB Entry: 1u5s (more details)
SCOPe Domain Sequences for d1u5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} qgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpkny vvvlsdgpalh
Timeline for d1u5sa1: