SCOPe 2.08: Domain d1u58a2: 1u58 A:8-144

Lineage for d1u58a2 (1u58 A:8-144)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species)

7. Species Murine cytomegalovirus [TaxId:10366] [110842] (2 PDB entries)
   Uniprot Q69G19 27-263 # 95% sequence identity

8. Domain d1u58a2: 1u58 A:8-144 [144388]
   Other proteins in same PDB: d1u58a1, d1u58b_
   missing some secondary structures that made up less than one-third of the common domain

Details for d1u58a2

PDB Entry: 1u58, 1.9 Å

PDB Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m144

PDB Compounds: (A:) MHC-I homolog m144

SCOPe Domain Sequences for d1u58a2:

Sequence, based on SEQRES records:

>d1u58a2 d.19.1.1 (A:8-144) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
esglryaytlvvdgtantrrcfgtghvdgeafvgysnnkthgigrwvnashveeenkefv
rqckelqaeldkmqnnskvigvktvqldvgctskiekhyaydgneteddtatsaserdrd
cqkklteyrklvlasav

Sequence, based on observed residues (ATOM records):

>d1u58a2 d.19.1.1 (A:8-144) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
esglryaytlvvdgtantrrcfgtghvdgeafvgysnnkthgigrwvnashveeenkefv
rqckelqaeldkmqnnskvigvktvqldvgctskiekhyaydgnetecqkklteyrklvl
asav

Timeline for d1u58a2:

• d1u58a2 first appeared in SCOP 1.75
  
• d1u58a2 appears in SCOPe 2.07