Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species) |
Species Murine cytomegalovirus [TaxId:10366] [110049] (2 PDB entries) Uniprot Q69G19 27-263 # 95% sequence identity |
Domain d1u58a1: 1u58 A:145-242 [144387] Other proteins in same PDB: d1u58a2, d1u58b_ |
PDB Entry: 1u58 (more details), 1.9 Å
SCOPe Domain Sequences for d1u58a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgn glyqkhidvyvdgglehvyscrvkgiatglelqivrwk
Timeline for d1u58a1: