SCOPe 2.04: Domain d1u58a1: 1u58 A:145-242

Lineage for d1u58a1 (1u58 A:145-242)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species)

7. Species Murine cytomegalovirus [TaxId:10366] [110049] (2 PDB entries)
   Uniprot Q69G19 27-263 # 95% sequence identity

8. Domain d1u58a1: 1u58 A:145-242 [144387]
   Other proteins in same PDB: d1u58a2, d1u58b_

Details for d1u58a1

PDB Entry: 1u58, 1.9 Å

PDB Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m144

PDB Compounds: (A:) MHC-I homolog m144

SCOPe Domain Sequences for d1u58a1:

Sequence; same for both SEQRES and ATOM records:

>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgn
glyqkhidvyvdgglehvyscrvkgiatglelqivrwk

Timeline for d1u58a1:

• d1u58a1 first appeared in SCOP 1.75
  
• d1u58a1 appears in SCOPe 2.03
  
• d1u58a1 appears in SCOPe 2.05
  
• d1u58a1 appears in the current release, SCOPe 2.08