Lineage for d1u58a1 (1u58 A:145-242)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109116Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species)
  7. 1109117Species Murine cytomegalovirus [TaxId:10366] [110049] (2 PDB entries)
    Uniprot Q69G19 27-263 # 95% sequence identity
  8. 1109118Domain d1u58a1: 1u58 A:145-242 [144387]
    Other proteins in same PDB: d1u58a2, d1u58b_

Details for d1u58a1

PDB Entry: 1u58 (more details), 1.9 Å

PDB Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m144
PDB Compounds: (A:) MHC-I homolog m144

SCOPe Domain Sequences for d1u58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgn
glyqkhidvyvdgglehvyscrvkgiatglelqivrwk

SCOPe Domain Coordinates for d1u58a1:

Click to download the PDB-style file with coordinates for d1u58a1.
(The format of our PDB-style files is described here.)

Timeline for d1u58a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u58a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1u58b_