Lineage for d1u3ha1 (1u3h A:2-116)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783828Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 783839Domain d1u3ha1: 1u3h A:2-116 [144383]
    Other proteins in same PDB: d1u3hc1, d1u3hc2, d1u3hd1, d1u3hd2, d1u3hg1, d1u3hg2, d1u3hh1, d1u3hh2
    mutant

Details for d1u3ha1

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (A:) T-cell receptor alpha-chain

SCOP Domain Sequences for d1u3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf
tiffnkrekklslhiadsqpgdsatyfcaasansgtyqrfgtgtklqvvp

SCOP Domain Coordinates for d1u3ha1:

Click to download the PDB-style file with coordinates for d1u3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1u3ha1: