Lineage for d1tu2b2 (1tu2 B:170-235)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817636Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 2817637Protein Cytochrome f, small domain [51257] (5 species)
  7. 2817658Species Nostoc sp. PCC 7120 [TaxId:103690] [159321] (1 PDB entry)
    Uniprot Q93SW9 214-279
  8. 2817659Domain d1tu2b2: 1tu2 B:170-235 [144381]
    Other proteins in same PDB: d1tu2a1, d1tu2b1
    complexed with cu, hec

Details for d1tu2b2

PDB Entry: 1tu2 (more details)

PDB Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
PDB Compounds: (B:) Apocytochrome f

SCOPe Domain Sequences for d1tu2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Nostoc sp. PCC 7120 [TaxId: 103690]}
nlysaaatgtiskiakqegedgsvkylvdiktesgevvsdtipagpelivsegqavtagd
altnnp

SCOPe Domain Coordinates for d1tu2b2:

Click to download the PDB-style file with coordinates for d1tu2b2.
(The format of our PDB-style files is described here.)

Timeline for d1tu2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tu2a1