![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
![]() | Protein Cytochrome f, small domain [51257] (5 species) |
![]() | Species Nostoc sp. PCC 7120 [TaxId:103690] [159321] (1 PDB entry) Uniprot Q93SW9 214-279 |
![]() | Domain d1tu2b2: 1tu2 B:170-235 [144381] Other proteins in same PDB: d1tu2a1, d1tu2b1 complexed with cu, hec |
PDB Entry: 1tu2 (more details)
SCOPe Domain Sequences for d1tu2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu2b2 b.84.2.2 (B:170-235) Cytochrome f, small domain {Nostoc sp. PCC 7120 [TaxId: 103690]} nlysaaatgtiskiakqegedgsvkylvdiktesgevvsdtipagpelivsegqavtagd altnnp
Timeline for d1tu2b2: