Lineage for d1sqxk1 (1sqx K:1-53)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887604Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 887605Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 887606Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 887607Species Cow (Bos taurus) [TaxId:9913] [81515] (15 PDB entries)
    Uniprot P07552
  8. 887612Domain d1sqxk1: 1sqx K:1-53 [144379]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxj1
    automatically matched to 1SQQ K:1-54
    complexed with fes, hem, sma, uq2

Details for d1sqxk1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOP Domain Sequences for d1sqxk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxk1 f.23.15.1 (K:1-53) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

SCOP Domain Coordinates for d1sqxk1:

Click to download the PDB-style file with coordinates for d1sqxk1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxk1: