Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries) Uniprot P00129 |
Domain d1sqpf1: 1sqp F:6-110 [144375] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vsassrwlekirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d1sqpf1: