SCOPe 2.07: Domain d1s0ha1: 1s0h A:1-141

Lineage for d1s0ha1 (1s0h A:1-141)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Donkey (Equus asinus) [TaxId:9793] [158217] (1 PDB entry)
   Uniprot P01959 1-141
   beta-chain sequences of donkey and horse hemoglobins are identical

8. Domain d1s0ha1: 1s0h A:1-141 [144372]
   Other proteins in same PDB: d1s0hb1
   complexed with hem

Details for d1s0ha1

PDB Entry: 1s0h, 3 Å

PDB Description: structure determination of haemoglobin from donkey(equus asinus) at 3.0 angstrom resolution

PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1s0ha1:

Sequence; same for both SEQRES and ATOM records:

>d1s0ha1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Donkey (Equus asinus) [TaxId: 9793]}
vlsaadktnvkaawskvggnagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1s0ha1:

• d1s0ha1 first appeared in SCOP 1.75
  
• d1s0ha1 appears in SCOPe 2.06
  
• d1s0ha1 appears in the current release, SCOPe 2.08