Lineage for d1s0ha1 (1s0h A:1-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758590Species Donkey (Equus asinus) [TaxId:9793] [158217] (1 PDB entry)
    Uniprot P01959 1-141
    beta-chain sequences of donkey and horse hemoglobins are identical
  8. 758591Domain d1s0ha1: 1s0h A:1-141 [144372]
    Other proteins in same PDB: d1s0hb1
    complexed with hem

Details for d1s0ha1

PDB Entry: 1s0h (more details), 3 Å

PDB Description: structure determination of haemoglobin from donkey(equus asinus) at 3.0 angstrom resolution
PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1s0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ha1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Donkey (Equus asinus) [TaxId: 9793]}
vlsaadktnvkaawskvggnagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d1s0ha1:

Click to download the PDB-style file with coordinates for d1s0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ha1: