| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Donkey (Equus asinus) [TaxId:9793] [158217] (1 PDB entry) Uniprot P01959 1-141 beta-chain sequences of donkey and horse hemoglobins are identical |
| Domain d1s0ha1: 1s0h A:1-141 [144372] Other proteins in same PDB: d1s0hb1 complexed with hem |
PDB Entry: 1s0h (more details), 3 Å
SCOPe Domain Sequences for d1s0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ha1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Donkey (Equus asinus) [TaxId: 9793]}
vlsaadktnvkaawskvggnagefgaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr
Timeline for d1s0ha1: