Lineage for d1ri8a1 (1ri8 A:2-125)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287449Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1287450Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 1287463Domain d1ri8a1: 1ri8 A:2-125 [144369]
    Other proteins in same PDB: d1ri8b_
    complexed with gol

Details for d1ri8a1

PDB Entry: 1ri8 (more details), 1.85 Å

PDB Description: Crystal Structure of the Camelid Single Domain Antibody 1D2L19 in complex with Hen Egg White Lysozyme
PDB Compounds: (A:) camelid ANTIBODY HEAVY CHAIN

SCOPe Domain Sequences for d1ri8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ri8a1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgykdrnycmgwfrrapgkeregvavidssgrtayad
svkgrftisrdvaldtaylqmnslkpedtamyycaagwsslgscgtnrnrynywgqgtqv
tvss

SCOPe Domain Coordinates for d1ri8a1:

Click to download the PDB-style file with coordinates for d1ri8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ri8a1: