SCOPe 2.05: Domain d1pvma4: 1pvm A:1-142

Lineage for d1pvma4 (1pvm A:1-142)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein Ta0289 [102899] (1 species)
   contains extra C-terminal zinc-finger domain

7. Species Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries)

8. Domain d1pvma4: 1pvm A:1-142 [144367]
   Other proteins in same PDB: d1pvma3, d1pvmb3
   structural genomics
   complexed with hg

Details for d1pvma4

PDB Entry: 1pvm, 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein Ta0289

SCOPe Domain Sequences for d1pvma4:

Sequence; same for both SEQRES and ATOM records:

>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Thermoplasma acidophilum [TaxId: 2303]}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
lsrylsrasitdillshrtkdy

Timeline for d1pvma4:

• d1pvma4 first appeared in SCOP 1.75
  
• d1pvma4 appears in SCOPe 2.04
  
• d1pvma4 appears in SCOPe 2.06
  
• d1pvma4 appears in the current release, SCOPe 2.08