Lineage for d1pvma4 (1pvm A:1-142)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858507Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 858508Superfamily d.37.1: CBS-domain pair [54631] (1 family) (S)
  5. 858509Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 858534Protein Hypothetical protein Ta0289 [102899] (1 species)
    contains extra C-terminal zinc-finger domain
  7. 858535Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102900] (2 PDB entries)
  8. 858536Domain d1pvma4: 1pvm A:1-142 [144367]
    Other proteins in same PDB: d1pvma3, d1pvmb3
    structural genomics

Details for d1pvma4

PDB Entry: 1pvm (more details), 1.5 Å

PDB Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum
PDB Compounds: (A:) conserved hypothetical protein Ta0289

SCOP Domain Sequences for d1pvma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
lsrylsrasitdillshrtkdy

SCOP Domain Coordinates for d1pvma4:

Click to download the PDB-style file with coordinates for d1pvma4.
(The format of our PDB-style files is described here.)

Timeline for d1pvma4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvma3