Lineage for d1pbja3 (1pbj A:2-121)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901515Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1901516Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1901517Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1901541Protein Hypothetical protein MTH1622 [102897] (1 species)
  7. 1901542Species Methanobacterium thermoautotrophicum [TaxId:145262] [102898] (1 PDB entry)
  8. 1901543Domain d1pbja3: 1pbj A:2-121 [144366]
    structural genomics
    complexed with mg

Details for d1pbja3

PDB Entry: 1pbj (more details), 1.4 Å

PDB Description: cbs domain protein
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1pbja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rvedvmvtdvdtiditasledvlrnyvenakgssvvvkegvrvgivttwdvleaiaegdd
laevkvwevmerdlvtispratikeaaekmvknvvwrllveeddeiigvisatdilrakm

SCOPe Domain Coordinates for d1pbja3:

Click to download the PDB-style file with coordinates for d1pbja3.
(The format of our PDB-style files is described here.)

Timeline for d1pbja3: