![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
![]() | Protein Hypothetical protein YhbO [89601] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89602] (1 PDB entry) |
![]() | Domain d1oi4b1: 1oi4 B:223-392 [144365] structural genomics |
PDB Entry: 1oi4 (more details), 2.03 Å
SCOP Domain Sequences for d1oi4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi4b1 c.23.16.2 (B:223-392) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} skkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksidev tpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirgrkl tavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllg
Timeline for d1oi4b1: