SCOPe 2.07: Domain d1o50a3: 1o50 A:1-145

Lineage for d1o50a3 (1o50 A:1-145)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Hypothetical protein TM0935 [102895] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102896] (1 PDB entry)

8. Domain d1o50a3: 1o50 A:1-145 [144363]
   Other proteins in same PDB: d1o50a4
   structural genomics

Details for d1o50a3

PDB Entry: 1o50, 1.87 Å

PDB Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution

PDB Compounds: (A:) CBS domain-containing predicted protein TM0935

SCOPe Domain Sequences for d1o50a3:

Sequence, based on SEQRES records:

>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]}
mkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhllkvs
gfhffgfipkeelirssmkrliaknaseimldpvyvhmdtpleealklmidnniqempvv
dekgeivgdlnsleillalwkgrek

Sequence, based on observed residues (ATOM records):

>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]}
mkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhllkvs
gfhffgfipsmkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekgeiv
gdlnsleillalwkgrek

Timeline for d1o50a3:

• d1o50a3 first appeared in SCOP 1.75
  
• d1o50a3 appears in SCOPe 2.06
  
• d1o50a3 appears in the current release, SCOPe 2.08