Lineage for d1o50a3 (1o50 A:1-145)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023693Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1023694Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1023695Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1023730Protein Hypothetical protein TM0935 [102895] (1 species)
  7. 1023731Species Thermotoga maritima [TaxId:2336] [102896] (1 PDB entry)
  8. 1023732Domain d1o50a3: 1o50 A:1-145 [144363]
    structural genomics

Details for d1o50a3

PDB Entry: 1o50 (more details), 1.87 Å

PDB Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution
PDB Compounds: (A:) CBS domain-containing predicted protein TM0935

SCOPe Domain Sequences for d1o50a3:

Sequence, based on SEQRES records: (download)

>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]}
mkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhllkvs
gfhffgfipkeelirssmkrliaknaseimldpvyvhmdtpleealklmidnniqempvv
dekgeivgdlnsleillalwkgrek

Sequence, based on observed residues (ATOM records): (download)

>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]}
mkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhllkvs
gfhffgfipsmkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekgeiv
gdlnsleillalwkgrek

SCOPe Domain Coordinates for d1o50a3:

Click to download the PDB-style file with coordinates for d1o50a3.
(The format of our PDB-style files is described here.)

Timeline for d1o50a3: