Lineage for d1nfba4 (1nfb A:112-231)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023693Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1023694Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1023695Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1023754Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 1023760Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)
  8. 1023764Domain d1nfba4: 1nfb A:112-231 [144361]
    Other proteins in same PDB: d1nfba1, d1nfbb1
    both CBS motifs are partly disordered in both chains, A and B
    complexed with cpr, nad

Details for d1nfba4

PDB Entry: 1nfb (more details), 2.9 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with 6Cl-IMP and NAD
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase 2

SCOPe Domain Sequences for d1nfba4:

Sequence, based on SEQRES records: (download)

>d1nfba4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh
dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

Sequence, based on observed residues (ATOM records): (download)

>d1nfba4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspgipitdtgrmgsapagitlkeaneilqrskkgklpivneddevaiian
r

SCOPe Domain Coordinates for d1nfba4:

Click to download the PDB-style file with coordinates for d1nfba4.
(The format of our PDB-style files is described here.)

Timeline for d1nfba4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfba1