| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
| Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries) |
| Domain d1nf7b4: 1nf7 B:112-231 [144360] Other proteins in same PDB: d1nf7a1, d1nf7b1 both CBS motifs are partly disordered in both chains, A and B complexed with k, myd, rvp, unk |
PDB Entry: 1nf7 (more details), 2.65 Å
SCOPe Domain Sequences for d1nf7b4:
Sequence, based on SEQRES records: (download)
>d1nf7b4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh
dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr
>d1nf7b4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkgiissrdidflehdcfleeimtkredlvvapagitlkeaneilqrsk
kgklpivneddelvaiiartlkknr
Timeline for d1nf7b4: